[Salaries in United Kingdom](https://jobicy.com/salaries/uk.md)2026 Salary Report

# Solutions Architect salary in United Kingdom.

The average salary for Solutions Architect in the United Kingdom is $126,200 per year, according to Jobicy salary data updated 8 Oct 2026. Entry-level positions start around $75,100–$104,500, while experienced professionals earn $149,700–$233,700.
Average compensation has decreased 0.9% over the past 12 months.
Demand is high, with a 20% annual growth rate.

Data: Jobicy salary estimates · Updated 8 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$126,200Estimated annual average$8,413Estimated monthly take-home$39.44–$94.04Hourly equivalent range8 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Solutions Architect role designs end-to-end technical solutions that balance requirements, security, integration, scale, cost, and operability. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include reliability, delivery lead time, defect rate, maintainability, and user impact. For United Kingdom, this report combines salary benchmarks in GBP with modeled assumptions for a 20% tax rate, 28 days of annual leave, and a 78.0 cost-of-living index relative to the United States baseline.

High accuracy1394 recent job listings and community reports shaped this estimateUpdated 8 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$126,200Annual benchmarkJunior$75,100–$104,5000-2 yearsMid-level$103,100–$155,6003-5 yearsSenior$149,700–$233,7006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 20% tax rate$8,413Hourly equivalentBased on a standard 40-hour week$39.44–$94.04Potential annual bonusIllustrative 10–15% performance range$12,620–$18,930

### Planning reference

Monthly savings target33% illustrative allocation$3,400Retirement contribution13% illustrative allocation$1,400Housing budgetIllustrative 20% monthly ceilingUp to $2,100Emergency fundThree to six months of gross income$31,550–$63,100

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 20% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Solutions Architect pay in United Kingdom.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Solutions Architect in United Kingdom](https://jobicy.com/api/jpgraph/chart.php?junior_min=75100&junior_max=104500&middle_min=103100&middle_max=155600&senior_min=149700&senior_max=233700&average=126200&currency=%24&currency_code=USD&title=Solutions%20Architect&country=United%20Kingdom)
Salary ranges

Enlarge
![Salary progression by experience for Solutions Architect in United Kingdom](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=89800&m_avg=129350&s_avg=191700&currency=%24&currency_code=USD&title=Solutions%20Architect&country=United%20Kingdom)
Experience growthEnlarge
![Illustrative monthly salary allocation for Solutions Architect in United Kingdom](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2103&savings=3449&retirement=1378&housing=2103&disposable=1483&currency=%24&currency_code=USD&title=Solutions%20Architect&country=United%20Kingdom)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 0.9% over the displayed period, moving from $127,300 to $126,200.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$126,200$39–$94Sep 2026$130,300$41–$97Aug 2026$123,600$39–$92Jul 2026$123,700$39–$92Jun 2026$125,400$39–$93May 2026$124,500$39–$93Apr 2026$128,100$40–$95Mar 2026$130,300$41–$97Feb 2026$126,500$40–$94Jan 2026$123,500$39–$92Dec 2025$122,000$38–$91Nov 2025$127,300$40–$95Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Solace logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/4e37a66b-221.png) Senior Backend EngineerSolace→](https://jobicy.com/jobs/155200-senior-backend-engineer-10.md) [![Solace logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/4e37a66b-221.png) Staff Software EngineerSolace→](https://jobicy.com/jobs/155199-staff-software-engineer-8.md) [![Cobalt logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/7a1fbbfd-221.jpg) Senior GTM Systems & AI SpecialistCobalt→](https://jobicy.com/jobs/155196-senior-gtm-systems-ai-specialist.md) [![Solace logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/4e37a66b-221.png) Senior Platform EngineerSolace→](https://jobicy.com/jobs/155202-senior-platform-engineer-4.md) [![Solace logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/4e37a66b-221.png) Technical Lead (Engineering)Solace→](https://jobicy.com/jobs/155201-technical-lead-engineering.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Solutions%20Architect.md)Career profile

## Pay drivers and skills for Solutions Architect.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Software designData structuresDebuggingTestingVersion controlAPI design

### Education requirements

A degree in computer science, software engineering, or equivalent production experienceEvidence of building, testing, and maintaining software beyond tutorial projects

### Training and development

Secure development lifecycle workshopsPerformance profiling practiceIncident response simulationsCloud deployment labsProduction architecture reviews

### Core skills

Software designData structuresDebuggingTestingVersion controlAPI designCode reviewTechnical documentation

### Trending and emerging skills

ObservabilitySecure codingAI-assisted developmentCloud-native developmentContinuous deliveryPlatform engineeringSoftware supply-chain securityAgentic development workflowsEdge computing

### Key responsibilities

Own the planning and delivery of work in the Solutions Architect remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against reliability, delivery lead time, defect rate, maintainability, and user impactInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

System scale and technical complexityDepth in the primary programming stackCloud, security, and reliability ownershipArchitecture and technical decision scopeProduction incident responsibilityMentoring and cross-team influence

### Typical career path

Entry-level or associate role in the disciplineSolutions ArchitectSenior Solutions ArchitectStaff or principal engineering, architecture, or engineering management

### Work specifics

Remote engineering team working through reviewed code, automated tests, and documented technical decisionsWorks with product, design, quality, security, and infrastructure partners throughout deliveryUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseGitGitHubDockerCI/CDPostmanSentryJira

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/uk/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/uk/ai-training-specialist.md)[API Integration Specialist →](https://jobicy.com/salaries/uk/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/uk/automation-engineer.md)[Blockchain Developer →](https://jobicy.com/salaries/uk/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/uk/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/uk/blockchain-security-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/uk/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/uk/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/uk/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/uk/cplusplus-developer.md)[Cybersecurity Analyst →](https://jobicy.com/salaries/uk/cybersecurity-analyst.md)[Data Engineer →](https://jobicy.com/salaries/uk/data-engineer.md)[Data Migration Specialist →](https://jobicy.com/salaries/uk/data-migration-specialist.md)[Database Administrator →](https://jobicy.com/salaries/uk/database-administrator.md)[DevOps Engineer →](https://jobicy.com/salaries/uk/devops-engineer.md)Market intelligence

## Hiring context for Solutions Architect in United Kingdom.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Evolution of remote collaboration practices incorporating AI-powered productivity tools and virtual reality meetings

###

Key industries

Software as a ServiceCloud ComputingFinTechE-commerceCybersecurityDeveloper ToolsCross-country pay scale

## Compare Solutions Architect pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$114,3009% lower](https://jobicy.com/salaries/ae/solutions-architect.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$82,20035% lower](https://jobicy.com/salaries/at/solutions-architect.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$136,8008% higher](https://jobicy.com/salaries/au/solutions-architect.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$97,30023% lower](https://jobicy.com/salaries/be/solutions-architect.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$128,0001% higher](https://jobicy.com/salaries/ca/solutions-architect.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$181,10044% higher](https://jobicy.com/salaries/ch/solutions-architect.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$115,0009% lower](https://jobicy.com/salaries/de/solutions-architect.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$64,80049% lower](https://jobicy.com/salaries/es/solutions-architect.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Solutions Architect salary in United Kingdom?

The estimated average annual salary is $126,200. Junior roles are estimated at $75,100–$104,500, while senior roles are estimated at $149,700–$233,700.

What is the hourly rate for this role?

The estimated hourly equivalent is between $39.44 and $94.04 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Software design, Data structures, Debugging, Testing, Version control. Trending and emerging requirements include Observability, Secure coding, AI-assisted development, Cloud-native development, Continuous delivery.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Solutions Architect in United Kingdom, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for United Kingdom and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Solutions Architect in United Kingdom, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Solutions%20Architect.md)[Salary API](https://jobicy.com/salary-api.md)