[Salaries in United States](https://jobicy.com/salaries/usa.md)2026 Salary Report

# Customer Acquisition Manager salary in United States.

The average salary for Customer Acquisition Manager in the United States is $103,200 per year, according to Jobicy salary data updated 6 Oct 2026. Entry-level positions start around $61,100–$82,000, while experienced professionals earn $122,400–$179,400.
Average compensation has increased 4.8% over the past 12 months.
Demand is high, with a 20% annual growth rate.

Data: Jobicy salary estimates · Updated 6 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$103,200Estimated annual average$6,536Estimated monthly take-home$32.25–$76.90Hourly equivalent range6 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The core purpose of a Customer Acquisition Manager is practical: the professional builds measurable acquisition programs that balance volume, customer fit, payback, and long-term value. Day-to-day priorities vary by company, but performance is generally visible in qualified demand, conversion, retention, brand lift, acquisition efficiency, and revenue contribution. For United States, this report combines salary benchmarks in USD with modeled assumptions for a 24% tax rate, 0 days of annual leave, and a 100.0 cost-of-living index relative to the United States baseline.

High accuracy2128 recent job listings and community reports shaped this estimateUpdated 6 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$103,200Annual benchmarkJunior$61,100–$82,0000-2 yearsMid-level$84,200–$123,0003-5 yearsSenior$122,400–$179,4006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 24% tax rate$6,536Hourly equivalentBased on a standard 40-hour week$32.25–$76.90Potential annual bonusIllustrative 10–15% performance range$10,320–$15,480

### Planning reference

Monthly savings target31% illustrative allocation$2,700Retirement contribution15% illustrative allocation$1,300Housing budgetIllustrative 20% monthly ceilingUp to $1,700Emergency fundThree to six months of gross income$25,800–$51,600

### Healthcare infrastructure

Private-market healthcare estimateIllustrative annual allowance for medical, dental, and vision insurance in a private-tier employment or contractor market≈ $6,192/year
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Customer Acquisition Manager pay in United States.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Customer Acquisition Manager in United States](https://jobicy.com/api/jpgraph/chart.php?junior_min=61100&junior_max=82000&middle_min=84200&middle_max=123000&senior_min=122400&senior_max=179400&average=103200&currency=%24&currency_code=USD&title=Customer%20Acquisition%20Manager&country=United%20States)
Salary ranges

Enlarge
![Salary progression by experience for Customer Acquisition Manager in United States](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=71550&m_avg=103600&s_avg=150900&currency=%24&currency_code=USD&title=Customer%20Acquisition%20Manager&country=United%20States)
Experience growthEnlarge
![Illustrative monthly salary allocation for Customer Acquisition Manager in United States](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2064&savings=2675&retirement=1290&housing=1720&disposable=851&currency=%24&currency_code=USD&title=Customer%20Acquisition%20Manager&country=United%20States)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 4.8% over the displayed period, moving from $98,500 to $103,200.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$103,200$32–$77Sep 2026$102,500$32–$76Aug 2026$99,900$31–$74Jul 2026$96,500$30–$72Jun 2026$97,200$30–$72May 2026$98,200$31–$73Apr 2026$100,600$31–$75Mar 2026$95,200$30–$71Feb 2026$93,500$29–$70Jan 2026$98,700$31–$74Dec 2025$98,300$31–$73Nov 2025$98,500$31–$73Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Workleap logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/b84329e1-221.png) Senior Product Designer - ShareGateWorkleap→](https://jobicy.com/jobs/155519-senior-product-designer-sharegate.md) [![Defense Unicorns logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/44a44784-221-1.png) Business Development Representative - CommercialDefense Unicorns→](https://jobicy.com/jobs/155504-business-development-representative-commercial.md) [![Invisible Technologies logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/5d284c35-221.jpeg) Senior Manager of Strategic StaffingInvisible Technologies→](https://jobicy.com/jobs/155502-senior-manager-of-strategic-staffing.md) [![Invisible Technologies logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/5d284c35-221.jpeg) Contract Technical RecruiterInvisible Technologies→](https://jobicy.com/jobs/155496-contract-technical-recruiter-2.md) [![GitLab logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201207055737-109952.jpg) Associate Renewals ManagerGitLab→](https://jobicy.com/jobs/155427-associate-renewals-manager.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Customer%20Acquisition%20Manager.md)Career profile

## Pay drivers and skills for Customer Acquisition Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Audience researchPositioningCampaign planningCopywritingAnalyticsExperimentation

### Education requirements

A degree in marketing, communications, business, or equivalent evidence of successful campaign workWorking knowledge of audience research, positioning, measurement, experimentation, and responsible data use

### Training and development

Conversion research practiceMessage testing labsMarketing automation exercisesMeasurement-plan workshopsPrivacy and consent training

### Professional certifications

Google Analytics certification

### Core skills

Audience researchPositioningCampaign planningCopywritingAnalyticsExperimentationChannel strategyPerformance reporting

### Trending and emerging skills

Marketing automationIncrementality testingAI-assisted content operationsLifecycle marketingFirst-party data strategyGenerative search optimizationPrivacy-preserving attributionSynthetic audience researchConversational discovery

### Key responsibilities

Own the planning and delivery of work in the Customer Acquisition Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against qualified demand, conversion, retention, brand lift, acquisition efficiency, and revenue contributionInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipChannel budget and revenue responsibilityDemonstrated acquisition or retention impactAnalytics and experimentation depthMarket and audience complexityBrand or lifecycle ownership

### Typical career path

Senior individual contributor or team leadCustomer Acquisition ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Distributed marketing team working from campaign briefs, shared calendars, experimentation plans, and performance dashboardsPartners with sales, product, design, content, data, customer teams, and external specialistsUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseGoogle Analytics 4HubSpotAhrefsSemrushLooker StudioCRM platformsProject tracking

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowancePerformance BonusesConference Attendance SupportMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/usa/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/usa/affiliate-program-manager.md)[AI Content Editor →](https://jobicy.com/salaries/usa/ai-content-editor.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/usa/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/usa/animation-director.md)[Brand Content Strategist →](https://jobicy.com/salaries/usa/brand-content-strategist.md)[Brand Strategist →](https://jobicy.com/salaries/usa/brand-strategist.md)[Business Analyst →](https://jobicy.com/salaries/usa/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/usa/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/usa/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/usa/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/usa/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/usa/community-success-manager.md)[Content Designer →](https://jobicy.com/salaries/usa/content-designer.md)[Content Optimization Lead →](https://jobicy.com/salaries/usa/content-optimization-lead.md)[Content Quality Manager →](https://jobicy.com/salaries/usa/content-quality-manager.md)Market intelligence

## Hiring context for Customer Acquisition Manager in United States.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Evolution of remote collaboration practices incorporating AI-powered productivity tools and virtual reality meetings

###

Key industries

Software as a ServiceE-commerceMedia and PublishingConsumer ProductsFinTechDigital AgenciesCross-country pay scale

## Compare Customer Acquisition Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$70,80031% lower](https://jobicy.com/salaries/ae/customer-acquisition-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$54,20047% lower](https://jobicy.com/salaries/at/customer-acquisition-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$89,40013% lower](https://jobicy.com/salaries/au/customer-acquisition-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$62,60039% lower](https://jobicy.com/salaries/be/customer-acquisition-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$88,40014% lower](https://jobicy.com/salaries/ca/customer-acquisition-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$114,80011% higher](https://jobicy.com/salaries/ch/customer-acquisition-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$76,10026% lower](https://jobicy.com/salaries/de/customer-acquisition-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$43,00058% lower](https://jobicy.com/salaries/es/customer-acquisition-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Customer Acquisition Manager salary in United States?

The estimated average annual salary is $103,200. Junior roles are estimated at $61,100–$82,000, while senior roles are estimated at $122,400–$179,400.

What is the hourly rate for this role?

The estimated hourly equivalent is between $32.25 and $76.90 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Audience research, Positioning, Campaign planning, Copywriting, Analytics. Trending and emerging requirements include Marketing automation, Incrementality testing, AI-assisted content operations, Lifecycle marketing, First-party data strategy.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Customer Acquisition Manager in United States, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for United States and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Customer Acquisition Manager in United States, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Customer%20Acquisition%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)