[Salaries in United States](https://jobicy.com/salaries/usa.md)2026 Salary Report

# Cybersecurity Analyst salary in United States.

The Cybersecurity Analyst role monitors and investigates threats, improves security controls, and communicates actionable risk. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include risk reduction, detection coverage, remediation time, control effectiveness, and incident severity. For United States, this report combines salary benchmarks in USD with modeled assumptions for a 24% tax rate, 0 days of annual leave, and a 100.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$111,700Estimated annual average$7,074Estimated monthly take-home$34.91–$83.24Hourly equivalent range5 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy2208 recent job listings and community reports shaped this estimateUpdated 5 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$111,700Annual benchmarkJunior$66,900–$86,9000-2 yearsMid-level$90,100–$136,1003-5 yearsSenior$130,800–$202,3006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 24% tax rate$7,074Hourly equivalentBased on a standard 40-hour week$34.91–$83.24Potential annual bonusIllustrative 10–15% performance range$11,170–$16,755

### Planning reference

Monthly savings target35% illustrative allocation$3,200Retirement contribution13% illustrative allocation$1,200Housing budgetIllustrative 20% monthly ceilingUp to $1,900Emergency fundThree to six months of gross income$27,925–$55,850

### Healthcare infrastructure

Private-market healthcare estimateIllustrative annual allowance for medical, dental, and vision insurance in a private-tier employment or contractor market≈ $6,702/year
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Cybersecurity Analyst pay in United States.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Cybersecurity Analyst in United States](https://jobicy.com/api/jpgraph/chart.php?junior_min=66900&junior_max=86900&middle_min=90100&middle_max=136100&senior_min=130800&senior_max=202300&average=111700&currency=%24&currency_code=USD&title=Cybersecurity%20Analyst&country=United%20States)
Salary ranges

Enlarge
![Salary progression by experience for Cybersecurity Analyst in United States](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=76900&m_avg=113100&s_avg=166550&currency=%24&currency_code=USD&title=Cybersecurity%20Analyst&country=United%20States)
Experience growthEnlarge
![Illustrative monthly salary allocation for Cybersecurity Analyst in United States](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2234&savings=3249&retirement=1173&housing=1862&disposable=791&currency=%24&currency_code=USD&title=Cybersecurity%20Analyst&country=United%20States)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 8% over the displayed period, moving from $103,400 to $111,700.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$111,700$35–$83Sep 2026$109,300$34–$81Aug 2026$107,800$34–$80Jul 2026$107,600$34–$80Jun 2026$110,800$35–$83May 2026$110,300$34–$82Apr 2026$106,500$33–$79Mar 2026$104,900$33–$78Feb 2026$110,300$34–$82Jan 2026$106,100$33–$79Dec 2025$109,700$34–$82Nov 2025$103,400$32–$77Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Huntress logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/91eae3ae-221.jpg) Security Operations Analyst- IrelandHuntress→](https://jobicy.com/jobs/155141-security-operations-analyst-ireland.md) [![Huntress logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/91eae3ae-221.jpg) Manager, Security Operations Center - EMEAHuntress→](https://jobicy.com/jobs/155134-manager-security-operations-center-emea.md) [![ExtraHop logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/4800f505-221.jpg) Software Engineer III | AI/MLExtraHop→](https://jobicy.com/jobs/153029-software-engineer-iii-ai-ml.md) [![ExtraHop logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/4800f505-221.jpg) Senior Data ScientistExtraHop→](https://jobicy.com/jobs/153021-senior-data-scientist-2.md) [![ExtraHop logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/4800f505-221.jpg) Principal Software Engineer | Data ScienceExtraHop→](https://jobicy.com/jobs/153013-principal-software-engineer-data-science.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Cybersecurity%20Analyst.md)Career profile

## Pay drivers and skills for Cybersecurity Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Threat modelingSecurity testingRisk assessmentIncident responseNetwork securityIdentity and access management

### Education requirements

A degree in cybersecurity, computer science, or equivalent hands-on security experienceDemonstrated knowledge of threat modeling, secure systems, incident handling, and responsible disclosure

### Training and development

Responsible disclosure trainingIncident response exercisesThreat-modeling workshopsCloud security labsSecure code review practice

### Professional certifications

Security+

### Core skills

Threat modelingSecurity testingRisk assessmentIncident responseNetwork securityIdentity and access managementSecurity documentationVulnerability management

### Trending and emerging skills

Detection engineeringSecurity automationZero trustCloud security posture managementSoftware supply-chain securityAI security testingPasskey adoptionConfidential computingPost-quantum readiness

### Key responsibilities

Own the planning and delivery of work in the Cybersecurity Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against risk reduction, detection coverage, remediation time, control effectiveness, and incident severityInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Security clearance or regulated-environment experienceIncident severity and on-call scopeThreat exposure and system criticalityCloud and application security depthIncident-response responsibilityRelevant security certificationsRegulatory and audit complexity

### Typical career path

Entry-level or associate role in the disciplineCybersecurity AnalystSenior Cybersecurity AnalystSecurity lead, principal security specialist, security architecture, or security management

### Work specifics

Security team balancing proactive assurance, monitoring, incident response, and clear risk communicationWorks with engineering, IT, legal, compliance, and leadership to reduce practical security exposureUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseBurp SuiteSIEMWiresharkNmapGitCloud security toolsTicketing systems

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/usa/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/usa/ai-training-specialist.md)[API Integration Specialist →](https://jobicy.com/salaries/usa/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/usa/automation-engineer.md)[Blockchain Developer →](https://jobicy.com/salaries/usa/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/usa/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/usa/blockchain-security-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/usa/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/usa/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/usa/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/usa/cplusplus-developer.md)[Data Engineer →](https://jobicy.com/salaries/usa/data-engineer.md)[Data Migration Specialist →](https://jobicy.com/salaries/usa/data-migration-specialist.md)[Database Administrator →](https://jobicy.com/salaries/usa/database-administrator.md)[DevOps Engineer →](https://jobicy.com/salaries/usa/devops-engineer.md)[Digital Forensics Analyst →](https://jobicy.com/salaries/usa/digital-forensics-analyst.md)Market intelligence

## Hiring context for Cybersecurity Analyst in United States.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Very High

Current hiring-demand signal for this role across the tracked market.

Growth

### 25% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Very High

Increasing remote opportunities with quarterly team meetups and annual company gatherings for maintaining team cohesion

###

Key industries

CybersecurityFinancial ServicesCloud ComputingGovernment TechnologyHealthcare TechnologyE-commerceCross-country pay scale

## Compare Cybersecurity Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$78,00030% lower](https://jobicy.com/salaries/ae/cybersecurity-analyst.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$60,10046% lower](https://jobicy.com/salaries/at/cybersecurity-analyst.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$98,20012% lower](https://jobicy.com/salaries/au/cybersecurity-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$68,10039% lower](https://jobicy.com/salaries/be/cybersecurity-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$94,70015% lower](https://jobicy.com/salaries/ca/cybersecurity-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$125,20012% higher](https://jobicy.com/salaries/ch/cybersecurity-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$84,30025% lower](https://jobicy.com/salaries/de/cybersecurity-analyst.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$45,70059% lower](https://jobicy.com/salaries/es/cybersecurity-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Cybersecurity Analyst salary in United States?

The estimated average annual salary is $111,700. Junior roles are estimated at $66,900–$86,900, while senior roles are estimated at $130,800–$202,300.

What is the hourly rate for this role?

The estimated hourly equivalent is between $34.91 and $83.24 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Threat modeling, Security testing, Risk assessment, Incident response, Network security. Trending and emerging requirements include Detection engineering, Security automation, Zero trust, Cloud security posture management, Software supply-chain security.

What is the market outlook?

Jobicy currently classifies demand as Very High, with a growth signal of 25% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Cybersecurity Analyst in United States, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for United States and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Cybersecurity Analyst in United States, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Cybersecurity%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)