[Salaries in United States](https://jobicy.com/salaries/usa.md)2026 Salary Report

# Supply Chain Analyst salary in United States.

The average salary for Supply Chain Analyst in the United States is $87,700 per year, according to Jobicy salary data updated 9 Oct 2026. Entry-level positions start around $51,000–$72,300, while experienced professionals earn $104,500–$157,300.
Average compensation has increased 2% over the past 12 months.
Demand is high, with a 20% annual growth rate.

Data: Jobicy salary estimates · Updated 9 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$87,700Estimated annual average$5,554Estimated monthly take-home$27.41–$65.35Hourly equivalent range9 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

A successful Supply Chain Analyst analyzes supply, inventory, logistics, suppliers, service levels, and risk to improve flow and resilience. Rather than measuring activity alone, organizations usually evaluate the role through accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insight. For United States, this report combines salary benchmarks in USD with modeled assumptions for a 24% tax rate, 0 days of annual leave, and a 100.0 cost-of-living index relative to the United States baseline.

High accuracy3446 recent job listings and community reports shaped this estimateUpdated 9 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$87,700Annual benchmarkJunior$51,000–$72,3000-2 yearsMid-level$71,200–$104,7003-5 yearsSenior$104,500–$157,3006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 24% tax rate$5,554Hourly equivalentBased on a standard 40-hour week$27.41–$65.35Potential annual bonusIllustrative 10–15% performance range$8,770–$13,155

### Planning reference

Monthly savings target27% illustrative allocation$2,000Retirement contribution14% illustrative allocation$1,000Housing budgetIllustrative 20% monthly ceilingUp to $1,500Emergency fundThree to six months of gross income$21,925–$43,850

### Healthcare infrastructure

Private-market healthcare estimateIllustrative annual allowance for medical, dental, and vision insurance in a private-tier employment or contractor market≈ $5,262/year
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Supply Chain Analyst pay in United States.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Supply Chain Analyst in United States](https://jobicy.com/api/jpgraph/chart.php?junior_min=51000&junior_max=72300&middle_min=71200&middle_max=104700&senior_min=104500&senior_max=157300&average=87700&currency=%24&currency_code=USD&title=Supply%20Chain%20Analyst&country=United%20States)
Salary ranges

Enlarge
![Salary progression by experience for Supply Chain Analyst in United States](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=61650&m_avg=87950&s_avg=130900&currency=%24&currency_code=USD&title=Supply%20Chain%20Analyst&country=United%20States)
Experience growthEnlarge
![Illustrative monthly salary allocation for Supply Chain Analyst in United States](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1754&savings=1995&retirement=987&housing=1462&disposable=1111&currency=%24&currency_code=USD&title=Supply%20Chain%20Analyst&country=United%20States)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 2% over the displayed period, moving from $86,000 to $87,700.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$87,700$27–$65Sep 2026$87,500$27–$65Aug 2026$86,900$27–$65Jul 2026$92,500$29–$69Jun 2026$92,100$29–$69May 2026$86,400$27–$64Apr 2026$88,600$28–$66Mar 2026$90,900$28–$68Feb 2026$85,000$27–$63Jan 2026$88,800$28–$66Dec 2025$84,800$27–$63Nov 2025$86,000$27–$64Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Echodyne logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/271d5f4a-221.png) Trade Compliance AnalystEchodyne→](https://jobicy.com/jobs/152890-trade-compliance-analyst.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Supply%20Chain%20Analyst.md)Career profile

## Pay drivers and skills for Supply Chain Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

SQLData analysisStatisticsData qualityData modelingVisualization

### Education requirements

A degree in statistics, mathematics, computer science, economics, or equivalent analytical experiencePractical evidence of turning incomplete data into reproducible analysis or dependable data products

### Training and development

Data governance workshopsExperiment design practiceDashboard accessibility reviewsPrivacy-aware analytics trainingAdvanced SQL and query optimization

### Core skills

SQLData analysisStatisticsData qualityData modelingVisualizationExperimentationBusiness communication

### Trending and emerging skills

Data governanceSemantic layersSelf-service analyticsModern data stacksAnalytics engineeringVector databasesReal-time analyticsData contractsAI-assisted analysis

### Key responsibilities

Own the planning and delivery of work in the Supply Chain Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insightCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Data volume, quality, and modeling complexityAdvanced SQL and analytical depthOwnership of trusted business metricsExperimentation and statistical expertiseModern data-platform experienceInfluence on high-value decisions

### Typical career path

Entry-level or associate role in the disciplineSupply Chain AnalystSenior Supply Chain AnalystLead analyst, analytics management, data science, or data-platform leadership

### Work specifics

Remote data team with shared metric definitions, versioned analysis, peer review, and governed accessTranslates questions from product, finance, operations, and leadership into measurable analytical workUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseSQLPythondbtTableauPower BISnowflakeGit

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/usa/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/usa/affiliate-program-manager.md)[AI Engineer →](https://jobicy.com/salaries/usa/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/usa/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/usa/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/usa/animation-director.md)[Blockchain Analyst →](https://jobicy.com/salaries/usa/blockchain-analyst.md)[Business Analyst →](https://jobicy.com/salaries/usa/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/usa/business-development-manager.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/usa/business-intelligence-analyst.md)[Change Management Consultant →](https://jobicy.com/salaries/usa/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/usa/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/usa/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/usa/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/usa/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/usa/conversion-optimization-manager.md)Market intelligence

## Hiring context for Supply Chain Analyst in United States.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Expanding global remote workforce supported by investment in virtual team building and online social engagement

###

Key industries

LogisticsManufacturingRetailE-commerceCross-country pay scale

## Compare Supply Chain Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$65,90025% lower](https://jobicy.com/salaries/ae/supply-chain-analyst.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$45,90048% lower](https://jobicy.com/salaries/at/supply-chain-analyst.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$77,10012% lower](https://jobicy.com/salaries/au/supply-chain-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$53,70039% lower](https://jobicy.com/salaries/be/supply-chain-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$75,60014% lower](https://jobicy.com/salaries/ca/supply-chain-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$101,50016% higher](https://jobicy.com/salaries/ch/supply-chain-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$66,30024% lower](https://jobicy.com/salaries/de/supply-chain-analyst.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$38,90056% lower](https://jobicy.com/salaries/es/supply-chain-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Supply Chain Analyst salary in United States?

The estimated average annual salary is $87,700. Junior roles are estimated at $51,000–$72,300, while senior roles are estimated at $104,500–$157,300.

What is the hourly rate for this role?

The estimated hourly equivalent is between $27.41 and $65.35 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include SQL, Data analysis, Statistics, Data quality, Data modeling. Trending and emerging requirements include Data governance, Semantic layers, Self-service analytics, Modern data stacks, Analytics engineering.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Supply Chain Analyst in United States, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for United States and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Supply Chain Analyst in United States, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Supply%20Chain%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)